TEX45 Antibody - middle region : HRP

TEX45 Antibody - middle region : HRP
Artikelnummer
AVIARP55899_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C19orf45

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: QALPGPPALRCKRASSGVELGDCKISYGSTCSEQKQAYRPQDLPEDRYDK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: testis-expressed protein 45

Protein Size: 491

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55899_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55899_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 374877
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×