English
TEX47 Antibody - N-terminal region : Biotin
TEX47 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55494_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC26647
Key Reference: Scherer,S.W., (2003) Science 300 (5620), 767-772
Molecular Weight: 29kDa
Peptide Sequence: Synthetic peptide located within the following region: EEKQRLHLKKFLLDRMFLVAKIQANVERKDVADYYEQMFQSVLKHHLGEA
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: testis-expressed protein 47
Protein Size: 253
Purification: Affinity Purified
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC26647
Key Reference: Scherer,S.W., (2003) Science 300 (5620), 767-772
Molecular Weight: 29kDa
Peptide Sequence: Synthetic peptide located within the following region: EEKQRLHLKKFLLDRMFLVAKIQANVERKDVADYYEQMFQSVLKHHLGEA
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: testis-expressed protein 47
Protein Size: 253
Purification: Affinity Purified
| Artikelnummer | AVIARP55494_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55494_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Cow (Bovine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 219557 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
