TEX47 Antibody - N-terminal region : HRP

TEX47 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55494_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC26647

Key Reference: Scherer,S.W., (2003) Science 300 (5620), 767-772

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: EEKQRLHLKKFLLDRMFLVAKIQANVERKDVADYYEQMFQSVLKHHLGEA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: testis-expressed protein 47

Protein Size: 253

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55494_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55494_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 219557
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×