TFEB Antibody - middle region : FITC

TFEB Antibody - middle region : FITC
Artikelnummer
AVIARP58116_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific diagnostic marker for renal neoplasms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFEB

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor EB

Protein Size: 476

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58116_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58116_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7942
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×