TFPI2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFPI2

Key Reference: Becker,J., (2008) Int. J. Oncol. 32 (1), 235-240

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tissue factor pathway inhibitor 2

Protein Size: 235

Purification: Affinity Purified

• Artikelnummer: AVIARP58242_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58242_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 7980
• Wirt: Rabbit