THYN1 Antibody - middle region : HRP

THYN1 Antibody - middle region : HRP
Artikelnummer
AVIARP54988_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THYN1

Key Reference: Song,A.X., (2005) Protein Expr. Purif. 42 (1), 146-152

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Thymocyte nuclear protein 1

Protein Size: 225

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54988_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54988_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29087
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×