TINAGL1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TINAGL1

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: ENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulointerstitial nephritis antigen-like

Protein Size: 467

Purification: Affinity Purified

• Artikelnummer: AVIARP57622_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57622_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 64129
• Wirt: Rabbit