TNF Antibody

TNF Antibody
Artikelnummer
ASBKC-066-50
Verpackungseinheit
50 μl
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Uniprot: P01375

Gene Name: TNF

Immunogen: Recombinant human TNF

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 79%

Core Sequence: SRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGI

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Rat - 78%

Alternative gene names: TNFA;TNFSF2

Alternative protein names: Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a) [Cleaved into: Tumor necrosis factor; membrane form; N-terminal fragment; NTF; Intracellular domain 1; ICD1; Intracellular domain 2; ICD2; C-domain 1; C-domain 2; Tumor necrosis factor; soluble form]

Protein name: Tumor necrosis factor

Product panel: Cytokines

Clone No.: K06288_6G6

Antigen Species: Human

Target Name: TNF

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-478

Cross reactivity: Not tested
Mehr Informationen
Artikelnummer ASBKC-066-50
Hersteller Absea Biotechnology
Hersteller Artikelnummer KC-066-50
Verpackungseinheit 50 μl
Mengeneinheit STK
Reaktivität Human
Klonalität Monoclonal
Methode Western Blotting
Isotyp IgG1
Human Gene ID 7124
Wirt Mouse
Konjugat Unconjugated
Produktinformation (PDF)
×
MSDS (PDF)
×