Traf3ip1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Traf3ip1 play an inhibitory role on IL13 signaling by binding to IL13RA1. It is involved in suppression of IL13-induced STAT6 phosphorylation, transcriptional activity and DNA-binding. It recruits TRAF3 and DISC1 to the microtubules.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Traf3ip1

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: VIRITGFMKGLYTDAEMKSENVKDKDAKISFLQKAIDVVMMVSGEPLAAK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TRAF3-interacting protein 1

Protein Size: 625

Purification: Affinity Purified

• Artikelnummer: AVIARP55316_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55316_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 74019
• Wirt: Rabbit