TSPAN33 Antibody - middle region : FITC

TSPAN33 Antibody - middle region : FITC
Artikelnummer
AVIARP55781_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TSPAN33 plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPAN33

Key Reference: Heikens,M.J., (2007) Blood 109 (8), 3244-3252

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tetraspanin-33

Protein Size: 283

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55781_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55781_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 340348
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×