TTC27 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of TTC27 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TTC27

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: KDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRREGDVLSNCE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tetratricopeptide repeat protein 27

Protein Size: 843

Purification: Affinity Purified

• Artikelnummer: AVIARP57019_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57019_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55622
• Wirt: Rabbit