TUBA8 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the alpha tubulin protein family. Alpha tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene are associated with polymicrogyria and optic nerve hypoplasia. Alternate splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUBA8

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: EPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin alpha-8 chain

Protein Size: 449

Purification: Affinity Purified

• Artikelnummer: AVIARP57298_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57298_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51807
• Wirt: Rabbit