Tuba8 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: ADGTFGTQASKINDDDSFTTFFSETGNGKHVPRAVMVDLEPTVVDEVRAG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubulin alpha-8 chain

Protein Size: 449

Purification: Affinity Purified

• Artikelnummer: AVIARP57297_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57297_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 53857
• Wirt: Rabbit