TXNDC4 Antibody - middle region : Biotin

TXNDC4 Antibody - middle region : Biotin
Artikelnummer
AVIARP58726_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXNDC4

Key Reference: Mariappan,M., (2008) J. Biol. Chem. 283 (10), 6375-6383

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endoplasmic reticulum resident protein 44

Protein Size: 406

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58726_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58726_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23071
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×