URG4 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.URG4 is upregulated in the presence of hepatitis B virus (HBV)-encoded X antigen (HBxAg) and may contribute to the development of hepatocellular carcinoma by promoting hepatocellular growth and survival (Tufan et al., 2002 [PubMed 12082552]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human URG4

Key Reference: Song,J., (2006) Neoplasia 8 (12), 995-1002

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ58708, weakly similar to Mus musculus GTPase, very large interferon inducible 1, transcript variant A, mRNA EMBL BAH13717.1

Protein Size: 888

Purification: Affinity Purified

• Artikelnummer: AVIARP56288_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56288_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55665
• Wirt: Rabbit