UTY Antibody : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein containing tetratricopeptide repeats which are thought to be involved in protein-protein interactions. The encoded protein is also a minor histocompatibility antigen which may induce graft rejection of male stem cell grafts. A large number of alternatively spliced transcripts have been observed for this gene, but the full length nature of some of these variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence YKSSLKHFQLALIDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL

Molecular Weight: 150 kDa

Peptide Sequence: Synthetic peptide located within the following region: YKSSLKHFQLALIDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone demethylase UTY

Protein Size: 1347

Purification: Affinity Purified

• Artikelnummer: AVIARP58214_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58214_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Human Gene ID: 7404
• Wirt: Rabbit