VPS53 Antibody - middle region : FITC

VPS53 Antibody - middle region : FITC
Artikelnummer
AVIARP57192_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VPS53

Molecular Weight: 92kDa

Peptide Sequence: Synthetic peptide located within the following region: VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein 53 homolog

Protein Size: 832

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57192_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57192_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55275
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×