WDFY1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. This gene encodes a protein which contains a single FYVE domain and multiple WD40 repeats. This protein is localized to endosomes.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WDFY1

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat and FYVE domain-containing protein 1

Protein Size: 410

Purification: Affinity Purified

• Artikelnummer: AVIARP57465_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57465_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57590
• Wirt: Rabbit