WDR21A Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR21A

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: ARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DDB1- and CUL4-associated factor 4

Protein Size: 495

Purification: Affinity Purified

• Artikelnummer: AVIARP55299_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55299_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26094
• Wirt: Rabbit