WDR55 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: WDR55 is a nucleolar protein that acts as a modulator of rRNA synthesis. WDR55 plays a central role during organogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR55

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: WD repeat-containing protein 55

Protein Size: 383

Purification: Affinity Purified

• Artikelnummer: AVIARP57011_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57011_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54853
• Wirt: Rabbit