WDTC1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: WDTC1 contains 2 TPR repeats and 7 WD repeats. WDTC1, the ortholog of Drosophila Adipose Gene, associates with human obesity, modulated by MUFA intake.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WDTC1

Key Reference: Hader,T., (2003) EMBO Rep. 4 (5), 511-516

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: PMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD and tetratricopeptide repeats protein 1

Protein Size: 676

Purification: Affinity Purified

• Artikelnummer: AVIARP55145_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55145_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23038
• Wirt: Rabbit