WDTC1 Antibody - N-terminal region : FITC

WDTC1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55145_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: WDTC1 contains 2 TPR repeats and 7 WD repeats. WDTC1, the ortholog of Drosophila Adipose Gene, associates with human obesity, modulated by MUFA intake.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WDTC1

Key Reference: Hader,T., (2003) EMBO Rep. 4 (5), 511-516

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: PMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD and tetratricopeptide repeats protein 1

Protein Size: 676

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55145_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55145_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23038
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×