WIPI1 Antibody - middle region : FITC

WIPI1 Antibody - middle region : FITC
Artikelnummer
AVIARP57076_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI su

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WIPI1

Key Reference: Eastman,S.W., (2007) FEBS Lett. 581 (18), 3396-3404

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat domain phosphoinositide-interacting protein 1

Protein Size: 446

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57076_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57076_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55062
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×