PTGES3 Antibody - middle region : FITC

PTGES3 Antibody - middle region : FITC
Artikelnummer
AVIARP58319_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PTGES3 is a molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTGES3

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prostaglandin E synthase 3

Protein Size: 160

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58319_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58319_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10728
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×