PTGES3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PTGES3 is a molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTGES3

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Prostaglandin E synthase 3

Protein Size: 160

Purification: Affinity Purified

• Artikelnummer: AVIARP58319_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58319_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10728
• Wirt: Rabbit