RAB23 Antibody - N-terminal region : HRP

RAB23 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56870_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation. Alternative splicing occurs at this locus and two transcript va

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB23

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-23

Protein Size: 237

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56870_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56870_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51715
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×