RAB40C Antibody - N-terminal region : FITC

RAB40C Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57519_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAB40C is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB40C

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-40C

Protein Size: 281

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57519_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57519_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57799
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×