RAC1 Antibody - middle region : Biotin

RAC1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57798_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAC1

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related C3 botulinum toxin substrate 1

Protein Size: 192

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57798_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57798_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5879
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×