RHOF Antibody - N-terminal region : Biotin

RHOF Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57309_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: RHOF is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state.It causes the formation of thin, actin-rich surface projections called filopodia. And it functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin- based morphology.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RHOF

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: DGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho-related GTP-binding protein RhoF

Protein Size: 211

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57309_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57309_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54509
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×