English
Rnf216 Antibody - N-terminal region : Biotin
Rnf216 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57824_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: Rnf216 acts as an E3 ubiquitin ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. It promotes degradation of TRAF3, TLR4 and TLR9. It contributes to the regulation of antiviral responses. It down-regulates activation of NF-kappa-B, IRF3 activation and IFNB production and promotes TNF and RIP mediated apoptosis.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Rnf216
Molecular Weight: 93kDa
Peptide Sequence: Synthetic peptide located within the following region: IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: E3 ubiquitin-protein ligase RNF216
Protein Size: 853
Purification: Affinity Purified
Description of Target: Rnf216 acts as an E3 ubiquitin ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. It promotes degradation of TRAF3, TLR4 and TLR9. It contributes to the regulation of antiviral responses. It down-regulates activation of NF-kappa-B, IRF3 activation and IFNB production and promotes TNF and RIP mediated apoptosis.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Rnf216
Molecular Weight: 93kDa
Peptide Sequence: Synthetic peptide located within the following region: IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: E3 ubiquitin-protein ligase RNF216
Protein Size: 853
Purification: Affinity Purified
| Artikelnummer | AVIARP57824_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57824_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 108086 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
