RRAGC Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the GTR/RAG GTP-binding protein family. The encoded protein is a monomeric guanine nucleotide-binding protein which forms a heterodimer with RRAGA and RRAGB and is primarily localized to the cytoplasm. The encoded protein promotes intracellular localization of the mTOR complex. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RRAGC

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related GTP-binding protein C

Protein Size: 399

Purification: Affinity Purified

• Artikelnummer: AVIARP57617_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57617_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 64121
• Wirt: Rabbit