Scyl3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Scyl3 may play a role in regulating cell adhesion/migration complexes in migrating cells.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: NGLSDVKNTSEDNGSFPAGSNKPEEWPDWSEPEEPEQQPASIHRWPREPC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein-associating with the carboxyl-terminal domain of ezrin

Protein Size: 735

Purification: Affinity Purified

• Artikelnummer: AVIARP57775_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57775_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 240880
• Wirt: Rabbit