SERPINB9 Antibody - C-terminal region : FITC

SERPINB9 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP59175_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPB9

Molecular Weight: 41 kDa

Peptide Sequence: Synthetic peptide located within the following region: LTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: serpin B9

Protein Size: 376

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP59175_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59175_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5272
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×