Skil Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: EQVMQQKCTCDSTLEKDREAEYAAQLAELRQRLDHAEADRQELQDELRQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative uncharacterized protein EMBL BAE42433.1

Protein Size: 629

Purification: Affinity Purified

• Artikelnummer: AVIARP58073_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58073_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 20482
• Wirt: Rabbit