SKIL Antibody - middle region : HRP

SKIL Antibody - middle region : HRP
Artikelnummer
AVIARP58074_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SKIL belongs to the SKI family and may have regulatory role in cell division or differentiation in response to extracellular signals.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SKIL

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: LQNEHAQRMEEFYVEQKDLEKKLEQIMKQKCTCDSNLEKDKEAEYAGQLA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ski-like protein

Protein Size: 638

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58074_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58074_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6498
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×