SLC25A6 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SLC25A6 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. SLC25A6 may participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A6

Key Reference: Yang,Z., (2007) Mol. Biol. Cell 18 (11), 4681-4689

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP/ATP translocase 3

Protein Size: 298

Purification: Affinity Purified

• Artikelnummer: AVIARP58528_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58528_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 293
• Wirt: Rabbit