Srgap1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: DAKELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECRG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SLIT-ROBO Rho GTPase-activating protein 1

Protein Size: 714

Purification: Affinity Purified

• Artikelnummer: AVIARP57446_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57446_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 117600
• Wirt: Rabbit