STK11 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: STK11is a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in its gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human STK11

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: EAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase STK11

Protein Size: 433

Purification: Affinity Purified

• Artikelnummer: AVIARP58959_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58959_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 6794
• Wirt: Rabbit