TFEB Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific diagnostic marker for renal neoplasms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFEB

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription factor EB

Protein Size: 476

Purification: Affinity Purified

• Artikelnummer: AVIARP58116_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58116_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rabbit, Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 7942
• Wirt: Rabbit