TIMP4 Antibody - middle region : HRP

TIMP4 Antibody - middle region : HRP
Artikelnummer
AVIARP59185_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. The secreted, netrin domain-containing protein encoded by this gene is involved in regulation of platelet aggregation and recruitment and may play role in hormonal regulation and endometrial tissue remodeling.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TIMP4

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: LCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Metalloproteinase inhibitor 4

Protein Size: 224

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59185_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59185_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7079
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×