TINAGL1 Antibody - middle region : HRP

TINAGL1 Antibody - middle region : HRP
Artikelnummer
AVIARP57622_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TINAGL1

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: ENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubulointerstitial nephritis antigen-like

Protein Size: 467

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57622_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57622_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64129
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×