TMEM166 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TMEM166 belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM166

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: AALVIRISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM176A

Protein Size: 152

Purification: Affinity Purified

• Artikelnummer: AVIARP58963_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58963_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Rabbit, Dog (Canine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 84141
• Wirt: Rabbit