TMPRSS3 Antibody - N-terminal region : Biotin

TMPRSS3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57684_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, a LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness. This gene is expressed in fetal cochlea and many other tissues, and is thought to be involved in the development and maintenance of the inner ear or the contents of the perilymph and endolymph. This gene was also identified as a tumor associated gene that is overexpressed in ovarian tumors. Alternatively spliced transcript variants have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMPRSS3

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Potential serine protease TMPRSS3 EMBL AAL56664.1

Protein Size: 344

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57684_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57684_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64699
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×