TP53INP2 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of TP53INP2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TP53INP2

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: RLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor protein p53-inducible nuclear protein 2

Protein Size: 220

Purification: Affinity Purified

• Artikelnummer: AVIARP58965_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58965_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 58476
• Wirt: Rabbit