TRIM15 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TRIM15 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Its function has not been identified. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM15

Key Reference: Uchil,P.D., PLoS Pathog. 4 (2), E16 (2008)

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: HLEIDSGVITLDPQTASRSLVLSEDRKSVRYTRQKKSLPDSPLRFDGLPA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tripartite motif-containing protein 15

Protein Size: 465

Purification: Affinity Purified

• Artikelnummer: AVIARP58130_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58130_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Rabbit, Cow (Bovine), Yeast
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 89870
• Wirt: Rabbit