TUBE1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUBE1

Key Reference: Chang,P. (2000) Nat. Cell Biol. 2 (1), 30-35

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin epsilon chain

Protein Size: 475

Purification: Affinity Purified

• Artikelnummer: AVIARP56869_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56869_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 51175
• Wirt: Rabbit