TUBE1 Antibody - middle region : HRP

TUBE1 Antibody - middle region : HRP
Artikelnummer
AVIARP56868_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUBE1

Key Reference: Chang,P. (2000) Nat. Cell Biol. 2 (1), 30-35

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubulin epsilon chain

Protein Size: 475

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56868_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56868_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51175
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×