VPS16 Antibody - N-terminal region : Biotin

VPS16 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57713_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps16 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS16

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: RGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 323

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57713_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57713_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64601
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×