Wnt3a Antibody - C-terminal region : FITC

Wnt3a Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58819_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Wnt3a is a ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Wnt-3a

Protein Size: 352

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58819_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58819_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 22416
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×