ZBED8 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC63920

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: SVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protein ZBED8

Protein Size: 594

Purification: Affinity Purified

• Artikelnummer: AVIARP57587_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57587_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 63920
• Wirt: Rabbit